DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and MGC107780

DIOPT Version :10

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001015692.1 Gene:MGC107780 / 548409 XenbaseID:XB-GENE-29099131 Length:308 Species:Xenopus tropicalis


Alignment Length:199 Identity:80/199 - (40%)
Similarity:106/199 - (53%) Gaps:5/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NGIHQLMLPEEEPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKL 94
            :|.:::....|.|..| ....|....|||.|||.||||:|.:.|.|||.|||....||::|...:
 Frog   111 SGWYKIYPDGERPLTVLCDMDTDGGGWIVFQRRWDGSVDFFRDWDSYKKGFGSQLSEFWLGNDNI 175

  Fly    95 YLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYS-GTAGDSLRYHINKRFS 158
            :.:|....::|.|..........:|.:|.|....|.:.||| .:|.|| |||||||.:|.|..||
 Frog   176 HTLTSAGTYKLRIDFTDFENQNSFAAYDSFATLGEKDNYKL-ILGAYSGGTAGDSLNHHRNCPFS 239

  Fly   159 TFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHW--GRWKFQSLTFVQIM 221
            |.|||||..:.|||....||||:.||..|:|||||.|...:....||:|  |:....|....::.
 Frog   240 TKDRDNDFHNINCADTFKGGWWYGSCHDSNLNGLYLRGKHSNEALGINWETGKGNGYSYKVTEMK 304

  Fly   222 IRPK 225
            .|||
 Frog   305 FRPK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 78/197 (40%)
MGC107780NP_001015692.1 Collagen 40..>72 CDD:460189
FReD 98..308 CDD:238040 78/197 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.