DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and fcn2

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_031747902.1 Gene:fcn2 / 548398 XenbaseID:XB-GENE-5789613 Length:312 Species:Xenopus tropicalis


Alignment Length:190 Identity:71/190 - (37%)
Similarity:101/190 - (53%) Gaps:6/190 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PEE-EPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQ 101
            ||. :|.:| ....|....|||.|||.|||||||:.|.|||.|||:...||::|.:.||.:|...
 Frog   123 PENTQPMKVLCDMHTDGGGWIVFQRRWDGSVNFNRDWNSYKTGFGNRLNEFWLGNENLYELTSSG 187

  Fly   102 PHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDE 166
            ..||.|:|:.......:..:..|::..|.:.|||.......|..|:|:..|:|..|||.  |||.
 Frog   188 TWELRIELQDFENVNYFVIYSSFKLLGEADKYKLLLGNLKEGNIGNSMDVHVNMPFSTL--DNDV 250

  Fly   167 SSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHW--GRWKFQSLTFVQIMIRP 224
            |...|.|::.||||::.|..::|||.|.....:...:||:|  |:....|....::.|||
 Frog   251 SPGKCVAKYKGGWWYNDCHHANLNGPYLPGQHSSYADGINWASGKGYHYSYKHSEMKIRP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 71/190 (37%)
fcn2XP_031747902.1 FReD 103..311 CDD:238040 71/190 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.