DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and ANGPTL4

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_005272541.1 Gene:ANGPTL4 / 51129 HGNCID:16039 Length:424 Species:Homo sapiens


Alignment Length:241 Identity:82/241 - (34%)
Similarity:118/241 - (48%) Gaps:44/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFEVGQSSP---HTCPSGSPNGIHQLMLPEEEPFQVTQCKTTA-RDWIVIQRRLDGSVNFNQSWF 74
            ||:||:...   ...|.|||            ||.| .||.|: ..|.|||||.||||:||:.|.
Human   191 LFQVGERQSGLFEIQPQGSP------------PFLV-NCKMTSDGGWTVIQRRHDGSVDFNRPWE 242

  Fly    75 SYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVG 139
            :||.|||||:|||::||:|::.:|.::...|.:||:...|......| ...:..|...|.|:...
Human   243 AYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQF-SVHLGGEDTAYSLQLTA 306

  Fly   140 KYSGTAGDSL--RYHINKRFSTFDRDND-ESSKNCA-----------AEH-------GGGWWFHS 183
            ..:|..|.:.  ...::..|||:|:|:| ...||||           .:|       .|||||.:
Human   307 PVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSAPSVAQRPDHVPSPLTPAGGWWFGT 371

  Fly   184 CLSSSLNGLYFR---EGETGMLNGIHWGRW--KFQSLTFVQIMIRP 224
            |..|:|||.|||   :....:..||.|..|  ::..|....::|:|
Human   372 CSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 77/224 (34%)
ANGPTL4XP_005272541.1 FReD 183..418 CDD:238040 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.