DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Angptl3

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_006238502.1 Gene:Angptl3 / 502970 RGDID:1564505 Length:455 Species:Rattus norvegicus


Alignment Length:213 Identity:64/213 - (30%)
Similarity:107/213 - (50%) Gaps:25/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HTCPSGSPNGIHQLMLPEEEPFQVTQCKT---TARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPN 84
            ||      :|::.:.....:.|.| .|.|   |.|  .:||.|.|||.||||:|.:|:.|||..:
  Rat   255 HT------SGVYTIRPSSSQVFNV-YCDTQSGTPR--TLIQHRKDGSQNFNQTWENYEKGFGRLD 310

  Fly    85 GEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSL 149
            |||::||:|:|.:.::..:.|.::|:....:..||.: .|.:.:....|.| .|.:.:....::|
  Rat   311 GEFWLGLEKIYAIVKQSNYILRLELQDWKDSKHYAEY-SFHLGNHETNYTL-HVAEIAANIPEAL 373

  Fly   150 RYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHS-CLSSSLNGLYFR---EGETGMLNGIHW--- 207
            ..|.:..|||:|. ..:....|...:.|||||.. |..::|||.|.:   :.:.....||.|   
  Rat   374 PEHRDLMFSTWDH-RAKGQLYCPESYSGGWWFSDMCGENNLNGKYNKPRAKSKPERRRGISWRPR 437

  Fly   208 -GRWKFQSLTFVQIMIRP 224
             |  |..|:...::|::|
  Rat   438 GG--KLYSIKSSKMMLQP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 62/208 (30%)
Angptl3XP_006238502.1 SPEC <34..193 CDD:295325
FReD 241..453 CDD:238040 63/211 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.