DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and angptl3

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001011408.1 Gene:angptl3 / 496885 XenbaseID:XB-GENE-6258790 Length:456 Species:Xenopus tropicalis


Alignment Length:201 Identity:62/201 - (30%)
Similarity:108/201 - (53%) Gaps:14/201 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NGIHQLMLPEEEPFQVTQCKTTARDW-IVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKL 94
            :||:.:.......|.| .|:.|:... .|||||.||||:|||:|.:|.:|||:..|||::||:|:
 Frog   252 SGIYTIRPNGSTAFDV-YCEITSESANTVIQRRTDGSVDFNQTWETYLNGFGELTGEFWLGLEKI 315

  Fly    95 YLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFST 159
            :.::::..:.|.|:|:.......:..: .|.:.::...|.|: :.:.||....:|.......|||
 Frog   316 HAISQQADYILHIELQDWKENWRFVEY-MFTLGNQDTSYALQ-LTQVSGNIPSALPEQREILFST 378

  Fly   160 FDRDNDESSKNCAAE-HGGGWWFHSCLSSSLNGLYFREGETGMLN-----GIHW--GRWKFQSLT 216
            .|:::.:  ..|.|| ..||||..:|..::|||.|.::.....|:     ||:|  .:.:..||.
 Frog   379 SDQNSGD--LKCPAETFSGGWWNTACSGTNLNGKYIKQRPRTKLDRRRGQGIYWKSEKGRLYSLK 441

  Fly   217 FVQIMI 222
            ..:||:
 Frog   442 STKIML 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 62/201 (31%)
angptl3NP_001011408.1 SMC_N <58..>206 CDD:330553
FReD 239..447 CDD:238040 61/199 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.