DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and angptl4

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001243132.1 Gene:angptl4 / 492647 ZFINID:ZDB-GENE-041111-222 Length:460 Species:Danio rerio


Alignment Length:237 Identity:74/237 - (31%)
Similarity:117/237 - (49%) Gaps:54/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFEVGQSSPHTCPSGSPNGIHQLMLPEEEPFQVTQCKTTAR-DWIVIQRRLDGSVNFNQSWFSYK 77
            ||..|::|         :|::.:...:.:||:| .|:.|.. .|.|||||.||||:|:|.|.:|:
Zfish   245 LFLRGETS---------SGLYTIQPSDSQPFEV-YCEMTPEGGWTVIQRRQDGSVDFDQLWQAYQ 299

  Fly    78 DGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDD-----------FQVDSETE 131
            :|||:.||||::||:|::.:::...:.|.:|            |.|           |.::.:..
Zfish   300 NGFGNLNGEFWLGLEKIHSVSKGGNYILKVQ------------FSDWRDEIQSISYRFHLNGQEN 352

  Fly   132 LYKLERVGKYSGTAGDSLRYHINK-RFSTFDRDNDESSK-NCAAEHGGGWWFHSCLSSSLNGLYF 194
            .|.|..:...:|....||....:. .|||.|:|||:.:. |||.:..|||||.:|..|:|||.||
Zfish   353 NYSLRILESPAGNTESSLPTETSAVPFSTRDKDNDQKNDLNCAKQLSGGWWFSNCGRSNLNGRYF 417

  Fly   195 ----------REGETGMLNGIHWGRW--KFQSLTFVQIMIRP 224
                      |:      .|:.|..|  ::..|....:||.|
Zfish   418 VTPAPKQRHQRK------QGVFWKTWRGRYYPLKTTTMMIAP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 70/223 (31%)
angptl4NP_001243132.1 DUF4795 78..>224 CDD:292662
FReD 240..453 CDD:238040 73/235 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.