DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and col11a2

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001005799.1 Gene:col11a2 / 448277 XenbaseID:XB-GENE-12564499 Length:340 Species:Xenopus tropicalis


Alignment Length:232 Identity:79/232 - (34%)
Similarity:113/232 - (48%) Gaps:23/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EVGQSSPHTCPSGSP------------------NGIHQLMLPEEEPFQV-TQCKTTARDWIVIQR 61
            |.|...| ..|||.|                  .|.:.:.|...:|.:| ....|....|||.||
 Frog   109 EKGDMGP-PGPSGPPGERAAKNCMELLNYGVLFTGWYTIYLDGNKPIKVLCDMDTDGGGWIVFQR 172

  Fly    62 RLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQV 126
            |:||||:|.:.|.|||.|||....||::|.:.::.:|.....:|...|:.......||.:..|::
 Frog   173 RVDGSVDFYRDWKSYKQGFGSQLSEFWLGNENIHRLTSSGNFQLRFDLEDFDNNRTYATYSQFRL 237

  Fly   127 DSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSK-NCAAEHGGGWWFHSCLSSSLN 190
            :.|::.|.|.......|.|||||..|.::.|||.|.|||.:|| |||..:.|.||:.||..|.||
 Frog   238 EPESQNYTLRFREFTGGPAGDSLFTHKDRAFSTKDADNDPASKTNCAERYKGAWWYESCYHSCLN 302

  Fly   191 GLYFREGETGMLNGIHWGRWK--FQSLTFVQIMIRPK 225
            |.|.|........|:||.:::  ..||...::.:||:
 Frog   303 GEYMRGQHDKADGGVHWAKFRGVNYSLKVSEMKLRPE 339

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 73/218 (33%)