DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and CG9593

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_650493.2 Gene:CG9593 / 41912 FlyBaseID:FBgn0038365 Length:382 Species:Drosophila melanogaster


Alignment Length:233 Identity:67/233 - (28%)
Similarity:107/233 - (45%) Gaps:33/233 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FEVGQSSPHTCPSG-SPNGIHQLMLPEEEPFQ----VTQC--KTTARDWIVIQRR---LDGSVNF 69
            ::..:|..|....| ..:|:::.::||....|    ...|  .|....|.|||.|   .|...||
  Fly   148 YQPAKSDCHELDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENF 212

  Fly    70 NQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYK 134
            |:||..|:.|||:.:.:|:.|.:..:.:.....|||.|:|:.......:|.:..|.:|||:..|:
  Fly   213 NRSWDEYRAGFGNLSRDFWFGNEFAHKILYRDDHELRIELQEAGEPLDWAEYPLFWLDSESYNYQ 277

  Fly   135 LERVGKYSGTAGDSLRYHINKRFSTFDRDND---ESSKNCAAEHGGGWWFHSCLSSSLNGLYFRE 196
            |...|::.|:..|:|..|....|||:||..:   .:...|..::||||||..|...:|||.:   
  Fly   278 LSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQCNLNGEH--- 339

  Fly   197 GETGMLNGIH--------WGRWK--FQSLTFVQIMIRP 224
                   |:|        |..|:  .......::||||
  Fly   340 -------GVHQRASPAIIWMNWRTGTDKPKSSRMMIRP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 65/220 (30%)
CG9593NP_650493.2 FReD 150..371 CDD:238040 67/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446489
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.