DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and fgg

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_998219.1 Gene:fgg / 406327 ZFINID:ZDB-GENE-040426-1998 Length:431 Species:Danio rerio


Alignment Length:229 Identity:75/229 - (32%)
Similarity:118/229 - (51%) Gaps:33/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GSPNGIHQLMLPEEEP--FQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFG----DPNG 85
            |..:|::.:. |...|  |.| .:..:..|.|.|:|||.||||:|:::|..||:|||    |...
Zfish   181 GKVSGLYYVK-PARAPEAFLVYCEIDSFGRGWTVLQRRRDGSVDFSKNWIQYKEGFGYLSPDDRT 244

  Fly    86 EFFIGLQKLYLMTREQ--PHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDS 148
            ||::|.:|::|::.:.  |:.|.|::....|...||.:..|::..|.:.|:|.....:.|.|||:
Zfish   245 EFWLGNEKIHLLSVQSSVPYVLRIEMVDWEGNKKYADYATFKLGPEVDAYRLTYAYYFGGDAGDA 309

  Fly   149 L--------------RYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREG-- 197
            .              ..|...:|||.|||||:...:||.:.|.|||.:.|.::.|||.|::.|  
Zfish   310 FDGYDFGDDPSDKFYTSHNGMQFSTVDRDNDKFQGHCAQQDGSGWWMNRCHAAHLNGKYYQGGKY 374

  Fly   198 -----ETGMLNGIHWGRW--KFQSLTFVQIMIRP 224
                 |:|..|||.|..|  ::.||....:.|.|
Zfish   375 TEKDAESGYDNGIIWATWHSRWYSLKETTMKIIP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 75/229 (33%)
fggNP_998219.1 Fib_alpha 32..166 CDD:285864
FReD 169..409 CDD:238040 75/229 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.