DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and mfap4.1

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001315274.1 Gene:mfap4.1 / 405825 ZFINID:ZDB-GENE-040426-2246 Length:242 Species:Danio rerio


Alignment Length:221 Identity:87/221 - (39%)
Similarity:117/221 - (52%) Gaps:16/221 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLFLWTLLFEV----GQSSPHTC----PSGSP-NGIHQLMLPEEEPFQV-TQCKTTARD-----W 56
            ||||.|||...    ..|.|..|    .||.. :|::.:....|.|..| .|..:..:|     |
Zfish     4 VLFLATLLSAALASDCTSMPFDCSDIYKSGETLSGVYTIYPAGETPVWVYCQMLSDGKDEENGGW 68

  Fly    57 IVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHF 121
            .|||||:||||||.:.|..||.|||:..||:::||:.||.:||.:...|.:.|:...|...:|.:
Zfish    69 TVIQRRMDGSVNFYRPWRDYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQY 133

  Fly   122 DDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLS 186
            ..|.|..|.|.|||:..|...|.|||||..|...:|||||:|.|...||||.|..|.:|:.||.:
Zfish   134 SSFSVGCECEGYKLQVSGFTDGGAGDSLSGHNGVKFSTFDKDQDTYDKNCAKEFLGAFWYGSCHT 198

  Fly   187 SSLNGLY-FREGETGMLNGIHWGRWK 211
            ::.|.:| :.|..|....|:.|..||
Zfish   199 TNPNAVYLWGEDATHHAIGVCWYTWK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 76/192 (40%)
mfap4.1NP_001315274.1 FReD 23..239 CDD:238040 79/202 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.