DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and CG7668

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster


Alignment Length:203 Identity:75/203 - (36%)
Similarity:107/203 - (52%) Gaps:29/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IHQLMLPEEEPFQ--VTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLY 95
            |..:.||:.|||.  .....:..|.|::||||:|||.: |.:..:...|.||..|||::|||||:
  Fly   236 IKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGSFD-NATESNIITGCGDLGGEFWLGLQKLH 299

  Fly    96 LMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHIN-----K 155
            .||..:..||:|||.....|:.||.:|:|.:..|.:.|||..:|:|||.|||:.|.|||     .
  Fly   300 KMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSHINHIIVGN 364

  Fly   156 RFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFR-EGETGMLNGIHWGRWKFQS---LT 216
            .|:.      ||||         ||  ..::.:|||.|.. :.|....:||.||.|...:   |.
  Fly   365 PFAM------ESSK---------WW--GTMNCNLNGKYRNSKVELDTTDGIWWGNWNVGNRYPLK 412

  Fly   217 FVQIMIRP 224
            ..:::|||
  Fly   413 SCKMLIRP 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 75/203 (37%)
CG7668NP_649170.1 DUF16 146..>212 CDD:279814
FReD 245..421 CDD:294064 72/194 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446498
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.