DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and fga

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001181918.1 Gene:fga / 378986 ZFINID:ZDB-GENE-031010-21 Length:684 Species:Danio rerio


Alignment Length:224 Identity:80/224 - (35%)
Similarity:125/224 - (55%) Gaps:29/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SGSPNGIHQLMLPEEEPFQVTQC--KTTARDWIVIQRRLDGSVNFNQSWFSYKDGFG----DPNG 85
            :|..:|:.::.....|......|  .|....|.::|:|.|||||||::|..|.:|||    ...|
Zfish   463 NGGQSGMFKIKPAGSEEVVEVYCDQSTGLGGWTLVQQREDGSVNFNRTWKEYLNGFGQIDKQGKG 527

  Fly    86 EFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSL- 149
            |.:||.:.|:|:|::: ..|.::|:...||..||.: :.:|.||.|.:.| ....|.|.|||:| 
Zfish   528 EIWIGNKFLHLLTQKE-SLLRVELQDWTGAEAYAEY-NIKVGSEAEGFPL-TASDYDGDAGDALV 589

  Fly   150 RYHIN---------KRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETG----- 200
            |.|.|         .:|||||||:|:..:|||..:|||||:::|.|::|||:|::.|:..     
Zfish   590 RGHPNLGSFLSHAGMKFSTFDRDSDKWEENCAEMYGGGWWYNNCQSANLNGIYYKGGQYDPATKV 654

  Fly   201 ---MLNGIHWGRWK--FQSLTFVQIMIRP 224
               :.||:.|..:|  ..||..|::.|||
Zfish   655 PYEIENGVVWLPFKPADYSLKVVRMKIRP 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 80/223 (36%)
fgaNP_001181918.1 Fib_alpha 46..185 CDD:285864
FReD 453..684 CDD:238040 80/224 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.