DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and CG30280

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster


Alignment Length:214 Identity:93/214 - (43%)
Similarity:135/214 - (63%) Gaps:11/214 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PHTC-PSGS-PNGIHQLMLPEEEPFQVTQCKT--TARDWIVIQRRLDGSVNFNQSWFSYKDGFGD 82
            |.:| .||. .||:|.|.:|...|||| .|:.  ....|||||:|..|:::|.::|..||:|||:
  Fly    67 PTSCLTSGDLENGLHTLKVPGLSPFQV-YCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGN 130

  Fly    83 PNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGD 147
            ...|:|:||:|:..:|..:||||::.|:.......:|.||:|.:.:|.:.|.:..:|||||||||
  Fly   131 LMDEYFLGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGD 195

  Fly   148 SLRYHINKRFSTFDRDND-ESSKNCAAEHGGGWWFHSCLSSSLNGLYFREG---ETGMLNGIHWG 208
            |||.|...:|||:||||| |.:||||..:.||||:::||.|:|||.|...|   |:....|:.|.
  Fly   196 SLRSHRKMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWR 260

  Fly   209 RWKFQSLTF--VQIMIRPK 225
            .|:..:..:  .|:|||||
  Fly   261 SWRGHNYGYRVTQMMIRPK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 88/205 (43%)
CG30280NP_611641.6 FReD 65..279 CDD:238040 91/212 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D84222at33392
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
88.000

Return to query results.
Submit another query.