DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Angptl4

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_954546.1 Gene:Angptl4 / 362850 RGDID:735058 Length:405 Species:Rattus norvegicus


Alignment Length:223 Identity:79/223 - (35%)
Similarity:116/223 - (52%) Gaps:26/223 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFEVGQSSPHTCPSGSPNGIHQLMLPEEEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKD 78
            ||:.|:..         :|:.|:......||.|....|:...|.||||||:|||:|||||.:|||
  Rat   190 LFQEGERH---------SGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKD 245

  Fly    79 GFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSG 143
            |||||.|||::||:|::.:|.::..:|.:||:...|......| ...:..|...|.|:..   ..
  Rat   246 GFGDPQGEFWLGLEKMHSITGDRGSQLAVQLQDWDGNAKLLQF-PIHLGGEDTAYSLQLT---EP 306

  Fly   144 TAGDSLRYHINKR-----FSTFDRDND-ESSKNCAAEHGGGWWFHSCLSSSLNGLYF----REGE 198
            ||.:....:::..     |||:|:|:| ....|||....|||||.:|..|:|||.||    |:.:
  Rat   307 TANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQ 371

  Fly   199 TGMLNGIHWGRWK--FQSLTFVQIMIRP 224
            . ...||.|..||  :..|....::|:|
  Rat   372 Q-RKKGIFWKTWKGRYYPLQATTLLIQP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 76/209 (36%)
Angptl4NP_954546.1 FReD 182..399 CDD:238040 79/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.