DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Fga

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001008724.1 Gene:Fga / 361969 RGDID:2603 Length:782 Species:Rattus norvegicus


Alignment Length:251 Identity:95/251 - (37%)
Similarity:134/251 - (53%) Gaps:44/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSCFFVLFLWTLLFEVGQSSPHTCPSGSPNGIHQLMLPEEEPFQVTQC--KTTARDWIVIQRRL 63
            |:.|..||              .|.|||:.|||..:.||.........|  :|:...|::||:|:
  Rat   545 MRDCDDVL--------------QTHPSGAQNGIFSIKLPGSSKIFSVYCDQETSLGGWLLIQQRM 595

  Fly    64 DGSVNFNQSWFSYKDGFGDPN----GEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDF 124
            |||:|||::|..||.|||..|    |||::|...|:|:|. :...|.::|:...|...||.: .|
  Rat   596 DGSLNFNRTWQDYKRGFGSLNDKGEGEFWLGNDYLHLLTL-RGSVLRVELEDWAGKEAYAEY-HF 658

  Fly   125 QVDSETELYKLERVGKYSGTAGDSL---------RY--HINKRFSTFDRDNDESSKNCAAEHGGG 178
            :|.||.|.|.|: |..|.|||||:|         .|  |.|.:|||||||.|:..:|||..:|||
  Rat   659 RVGSEAEGYALQ-VSSYQGTAGDALMEGSVEEGTEYTSHSNMQFSTFDRDADQWEENCAEVYGGG 722

  Fly   179 WWFHSCLSSSLNGLYFREGETG--------MLNGIHW--GRWKFQSLTFVQIMIRP 224
            ||::||.:::|||:|:..|...        :.||:.|  .|....||..|::.|||
  Rat   723 WWYNSCQAANLNGIYYPGGTYDPRNNSPYEIENGVVWVPFRGADYSLRAVRMKIRP 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 88/224 (39%)
FgaNP_001008724.1 Fib_alpha 51..189 CDD:285864
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..374
Fibrinogen_aC 388..453 CDD:288972
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..542
FReD 546..779 CDD:238040 94/250 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.