DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and fgb

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_997939.1 Gene:fgb / 337315 ZFINID:ZDB-GENE-030131-9261 Length:485 Species:Danio rerio


Alignment Length:261 Identity:81/261 - (31%)
Similarity:129/261 - (49%) Gaps:60/261 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TCP--------------SGSPNGIHQLMLPEE--EPFQVTQCKTTARD--WIVIQRRLDGSVNFN 70
            |||              .|..:....::.|:.  .|::|. |..|:::  |::||.|:||||:|.
Zfish   225 TCPIPVVSGKECEDIIRKGGEDSQMYIIRPDPLGTPYKVF-CDQTSKNGGWVLIQNRMDGSVDFG 288

  Fly    71 QSWFSYKDGFGD-----------PNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDF 124
            :.|..|:.|||:           ..||:::|..::..:::....||.::::...|:.|||.::.|
Zfish   289 RRWDDYRRGFGNIAFDVGKGHCQTPGEYWLGNDRISQLSKMGATELLVEMEDWSGSKVYAQYEQF 353

  Fly   125 QVDSETELYKLERVGKYSGTAGD--------------SLRYHINKRFSTFDRDND-----ESSKN 170
            .:..|...|.| .||:||||||:              ::..|....|||:|||||     :.||.
Zfish   354 SMQGEASNYIL-GVGRYSGTAGNTFLEGATELFGENRTMTIHNGMMFSTYDRDNDKWIPGDPSKQ 417

  Fly   171 CAAEHGGGWWFHSCLSSSLNGLYFREG-------ETGMLNGIHWGRWK--FQSLTFVQIMIRPKY 226
            |:.|.|||||::.|.|.:.||.|:..|       :.|..:||.|..||  :.||..:.:.||| |
Zfish   418 CSKEDGGGWWYNRCHSCNPNGRYYWGGAYTKYMAKHGTDDGIVWMNWKGSWYSLKTISMKIRP-Y 481

  Fly   227 F 227
            |
Zfish   482 F 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 75/239 (31%)
fgbNP_997939.1 Fib_alpha 87..229 CDD:285864 3/3 (100%)
FReD 232..481 CDD:294064 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.