DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and CG1889

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster


Alignment Length:197 Identity:81/197 - (41%)
Similarity:111/197 - (56%) Gaps:19/197 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EPFQVTQCKTTARD--WIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHE 104
            |||.|. |....|:  |.::..|.|||.:||:.|..||.|||....||||||.||:.:|....:|
  Fly   145 EPFFVF-CDQKVRNGGWTMVVNRYDGSEDFNRKWADYKIGFGPLTTEFFIGLDKLHQITSSDNYE 208

  Fly   105 LFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSK 169
            |.:||::......||.:|.|.:.||:|.|:|..:|.|.|.|.|:||.|..|:|||.||.|||:.:
  Fly   209 LLVQLQNRKQELRYALYDHFSIGSESEQYRLNVLGDYHGDAADALRDHTGKKFSTHDRVNDENEQ 273

  Fly   170 NCAAEHGGGWWF-HSCLSSSLNGLYFR--EGETGMLNGIHW--------GRWKFQSLTFVQIMIR 223
            ||||:..|.:|: .||..::..|||.|  |.:.....||.|        |     ||..|::|:|
  Fly   274 NCAAQQSGAFWYGGSCNLTNPFGLYQRLLERDVDGFKGILWRGFLNGPKG-----SLKIVRMMVR 333

  Fly   224 PK 225
            |:
  Fly   334 PR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 80/195 (41%)
CG1889NP_727376.2 Lzipper-MIP1 <34..80 CDD:291087
FReD 123..335 CDD:238040 80/195 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D94621at50557
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
98.900

Return to query results.
Submit another query.