DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and CG1791

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster


Alignment Length:212 Identity:89/212 - (41%)
Similarity:122/212 - (57%) Gaps:9/212 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SPHTCPSGSPNGIHQLMLPEEEPFQVTQCKTTARD--WIVIQRRLDGSVNFNQSWFSYKDGFGDP 83
            :|..|.......:...:.|:.||| ...|....||  |:||..|.|||.:||:.|.:||.|||..
  Fly   120 TPRNCYDEKHGQVRIRIAPDMEPF-FASCDQKVRDGGWMVIAYRFDGSEDFNKDWQNYKAGFGAL 183

  Fly    84 NGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDS 148
            |.||||||.||:.:|..:.|||.|.:|...|...:|.:|.|.:.||:|.|.|..:|.|.|.||||
  Fly   184 NSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGAYKGDAGDS 248

  Fly   149 LRYHINKRFSTFDRDNDESSKNCAAEHGGGWWF-HSCLSSSLNGLYFRE--GETGMLNGIHWGRW 210
            ||||..|:|:|||:|||::.:|||..|.|.||: ..|..|:|.|.:..:  .|.|...||.|..:
  Fly   249 LRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKSF 313

  Fly   211 ---KFQSLTFVQIMIRP 224
               ...||::|:::|||
  Fly   314 LPGPTGSLSYVRMLIRP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 87/205 (42%)
CG1791NP_572591.1 FReD 119..331 CDD:238040 89/212 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446512
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D94621at50557
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
98.900

Return to query results.
Submit another query.