DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Angptl3

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_038941.1 Gene:Angptl3 / 30924 MGIID:1353627 Length:455 Species:Mus musculus


Alignment Length:210 Identity:59/210 - (28%)
Similarity:107/210 - (50%) Gaps:19/210 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HTCPSGSPNGIHQLMLPEEEPFQVTQCKT-TARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGE 86
            ||      :|::.:.....:.|.| .|.| :...|.:||.|.|||.:||::|.:|:.|||..:||
Mouse   255 HT------SGVYTIKPRNSQGFNV-YCDTQSGSPWTLIQHRKDGSQDFNETWENYEKGFGRLDGE 312

  Fly    87 FFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRY 151
            |::||:|:|.:.::..:.|.::|:....:..|..: .|.:.|....|.| .|.:.:|....:|..
Mouse   313 FWLGLEKIYAIVQQSNYILRLELQDWKDSKHYVEY-SFHLGSHETNYTL-HVAEIAGNIPGALPE 375

  Fly   152 HINKRFSTFDRDNDESSKNCAAEHGGGWWFHS-CLSSSLNGLYFR---EGETGMLNGIHW---GR 209
            |.:..|||::. ..:....|...:.||||::. |..::|||.|.:   :.......||:|   .|
Mouse   376 HTDLMFSTWNH-RAKGQLYCPESYSGGWWWNDICGENNLNGKYNKPRTKSRPERRRGIYWRPQSR 439

  Fly   210 WKFQSLTFVQIMIRP 224
             |..::...::|::|
Mouse   440 -KLYAIKSSKMMLQP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 57/205 (28%)
Angptl3NP_038941.1 Sufficient to inhibit LIPG/EL phospholipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1 17..207
Sufficient to inhibit LPL lipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1, ECO:0000269|PubMed:20581395 17..165
Required for inhibition of LPL lipase activity. /evidence=ECO:0000250|UniProtKB:Q9Y5C1 32..56
SPEC <34..191 CDD:295325
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..242
FReD 241..453 CDD:238040 58/208 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.