DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Angptl6

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001100172.1 Gene:Angptl6 / 298698 RGDID:1311141 Length:457 Species:Rattus norvegicus


Alignment Length:158 Identity:73/158 - (46%)
Similarity:105/158 - (66%) Gaps:3/158 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAH 120
            |.|||||.||||||..:|..||.|||.|:||:::||:.::.:|....|||.|.||...|....||
  Rat   283 WTVIQRRQDGSVNFFTNWQHYKVGFGRPDGEYWLGLEPVHQVTSRGDHELLILLKDWGGRGARAH 347

  Fly   121 FDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCL 185
            :|.|.::.|::.|:| |:|:|.|.|||||.:|.:|.|:|.|||.|..|.|||..|.||||:|:|.
  Rat   348 YDSFSLEPESDHYRL-RLGQYHGDAGDSLSWHSDKPFNTVDRDRDSYSGNCALYHRGGWWYHACA 411

  Fly   186 SSSLNGLYFREG--ETGMLNGIHWGRWK 211
            .|:|||:::..|  .:...:|::|..::
  Rat   412 HSNLNGVWYHGGHYRSRYQDGVYWAEFR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 73/158 (46%)
Angptl6NP_001100172.1 Uso1_p115_C 66..>157 CDD:282695
FReD 242..453 CDD:238040 73/158 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.