DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Mfap4

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_006246622.1 Gene:Mfap4 / 287382 RGDID:1307841 Length:281 Species:Rattus norvegicus


Alignment Length:204 Identity:76/204 - (37%)
Similarity:104/204 - (50%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEF------------------------FIGL 91
            |....|.|.|:|.:|||:|.:.|..||.|||..:||:                        ::||
  Rat    76 TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGKVGSWGGGCPLANSWLTSCHPYLGL 140

  Fly    92 QKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQ-----VDSETELYKLERVGKYSGTAGDSLRY 151
            |.|:|:|.:|.:||.:.|:.....|.||.:.||.     |.:|.:.|.|...|...|.|||||.|
  Rat   141 QNLHLLTLKQKYELRVDLEDFENNTAYAKYVDFSISPNAVSAEEDGYTLYVAGFEDGGAGDSLSY 205

  Fly   152 HINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHWGRWK--FQS 214
            |..::|||||||.|...:||||...|.:||.||..::|||.|.........|||:|.:||  :.|
  Rat   206 HSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYS 270

  Fly   215 LTFVQIMIR 223
            |...::.||
  Rat   271 LKRTEMKIR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 76/204 (37%)
Mfap4XP_006246622.1 FReD 38..280 CDD:238040 76/204 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.