DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and ANGPT2

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001138.1 Gene:ANGPT2 / 285 HGNCID:485 Length:496 Species:Homo sapiens


Alignment Length:214 Identity:82/214 - (38%)
Similarity:115/214 - (53%) Gaps:14/214 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SPHTCPSGSPNGIHQLMLPE--EEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDP 83
            |.||     .|||:.|..|.  ||.......:.....|.:||||.||||:|.::|..||.|||:|
Human   290 SGHT-----TNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNP 349

  Fly    84 NGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAG-- 146
            :||:::|.:.:..:|.:|.:.|.|.||...|...|:.::.|.:.||...|::...| .:||||  
Human   350 SGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKG-LTGTAGKI 413

  Fly   147 DSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGE-TGMLNGIHWGRW 210
            .|:....|. |||.|.|||:....|:....|||||.:|..|:|||:|:.:.: |...|||.|..|
Human   414 SSISQPGND-FSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYW 477

  Fly   211 KFQ--SLTFVQIMIRPKYF 227
            |..  ||....:||||..|
Human   478 KGSGYSLKATTMMIRPADF 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 77/203 (38%)
ANGPT2NP_001138.1 SMC_N <78..>295 CDD:330553 3/9 (33%)
FBG 280..494 CDD:214548 80/210 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.