DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and ANGPTL5

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_835228.2 Gene:ANGPTL5 / 253935 HGNCID:19705 Length:388 Species:Homo sapiens


Alignment Length:231 Identity:78/231 - (33%)
Similarity:126/231 - (54%) Gaps:38/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SPNGIHQLMLPE--EEPFQVTQCKTTARDW--IVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFI 89
            :|:|:: ::.||  ..||:| .|....|..  .|||:|:||.::|.:.|..|.|||||..|||::
Human   163 TPSGLY-IIHPEGSSYPFEV-MCDMDYRGGGRTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWL 225

  Fly    90 GLQKLYLMTREQ--PHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYH 152
            ||:|::.:..::  ...|::.|:.......||.:|:|.::.||..:|: .:|:|||.|||:.| .
Human   226 GLKKIFYIVNQKNTSFMLYVALESEDDTLAYASYDNFWLEDETRFFKM-HLGRYSGNAGDAFR-G 288

  Fly   153 INKR-------FSTFDRDND----------ESSKNCAAEHG-GGWWFHSCLSSSLNGLYFREGET 199
            :.|.       |||.|.|||          :|.|:|:..|. .||||:.|..::|||::...|:.
Human   289 LKKEDNQNAMPFSTSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIHHFSGKL 353

  Fly   200 GMLNGIHWGRW-------KFQSLTF-VQIMIRPKYF 227
             :..||.||.|       |.:|::. ::.|..| ||
Human   354 -LATGIQWGTWTKNNSPVKIKSVSMKIRRMYNP-YF 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 75/227 (33%)
ANGPTL5NP_835228.2 FReD 146..382 CDD:238040 74/223 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.