DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and CG30281

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster


Alignment Length:216 Identity:92/216 - (42%)
Similarity:125/216 - (57%) Gaps:16/216 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SPHTCPSG--SPNGIHQLMLPEEEPFQVTQCKT--TARDWIVIQRRLDGSVNFNQSWFSYKDGFG 81
            :|.:|.:.  :.||||.:.:|..|||.| .|.|  ....|.|||||.|||.||.:.|..|..|||
  Fly    64 NPSSCLAAGINSNGIHVIEVPGLEPFPV-YCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFG 127

  Fly    82 DPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAG 146
            :.:||||:||:||:.:|..:|:|||:.::...|....|.::||.:.:.:..|.|..:|||||.||
  Fly   128 ELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAG 192

  Fly   147 DSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGE-----TGMLNGIH 206
            ||||||....||||  |:|::...||..:.|.||:..|..|:|||.|...|.     :|  .||.
  Fly   193 DSLRYHKGMPFSTF--DHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSG--RGIT 253

  Fly   207 WGRWK--FQSLTFVQIMIRPK 225
            |..|:  .....|||:|||||
  Fly   254 WMSWRGYDYGYKFVQMMIRPK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 88/207 (43%)
CG30281NP_726164.1 FReD 63..274 CDD:238040 90/214 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472936
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D84222at33392
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
98.900

Return to query results.
Submit another query.