Sequence 1: | NP_723894.2 | Gene: | CG31832 / 318970 | FlyBaseID: | FBgn0051832 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038957639.1 | Gene: | Fgb / 24366 | RGDID: | 2604 | Length: | 504 | Species: | Rattus norvegicus |
Alignment Length: | 218 | Identity: | 76/218 - (34%) |
---|---|---|---|
Similarity: | 110/218 - (50%) | Gaps: | 44/218 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 LMLPE--EEPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGD-------------PN 84
Fly 85 GEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSL 149
Fly 150 --------------RYHINKRFSTFDRDND-----ESSKNCAAEHGGGWWFHSCLSSSLNGLYFR 195
Fly 196 EG-------ETGMLNGIHWGRWK 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31832 | NP_723894.2 | FReD | 28..225 | CDD:238040 | 76/218 (35%) |
Fgb | XP_038957639.1 | Fib_alpha | 80..222 | CDD:400857 | |
FReD | 225..462 | CDD:412152 | 76/218 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |