DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Fgb

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_038957639.1 Gene:Fgb / 24366 RGDID:2604 Length:504 Species:Rattus norvegicus


Alignment Length:218 Identity:76/218 - (34%)
Similarity:110/218 - (50%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LMLPE--EEPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGD-------------PN 84
            |:.|:  .:|::| ...||....|.|||.|.||||:|.:.|..||.|||:             | 
  Rat   244 LIQPDTSSKPYRVYCDMKTENGGWTVIQNRQDGSVDFGRKWDPYKKGFGNIATNEDTKKYCGLP- 307

  Fly    85 GEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSL 149
            ||:::|..|:..:||..|.||.|:::...|..|.||:..|.|.:|...|::. |.||.||||::|
  Rat   308 GEYWLGNDKISQLTRIGPTELLIEMEDWKGDKVKAHYGGFTVQTEANKYQVS-VNKYKGTAGNAL 371

  Fly   150 --------------RYHINKRFSTFDRDND-----ESSKNCAAEHGGGWWFHSCLSSSLNGLYFR 195
                          ..|....|||:|||||     :..|.|:.|.|||||::.|.:::.||.|:.
  Rat   372 MEGASQLVGENRTMTIHNGMFFSTYDRDNDGWVTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYW 436

  Fly   196 EG-------ETGMLNGIHWGRWK 211
            .|       :.|..:|:.|..||
  Rat   437 GGLYSWDMSKHGTDDGVVWMNWK 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 76/218 (35%)
FgbXP_038957639.1 Fib_alpha 80..222 CDD:400857
FReD 225..462 CDD:412152 76/218 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.