DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Fgl1

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_663569.2 Gene:Fgl1 / 234199 MGIID:102795 Length:314 Species:Mus musculus


Alignment Length:191 Identity:78/191 - (40%)
Similarity:108/191 - (56%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WIVIQRRLDGSVNFNQSWFSYKDGFGD---PNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATV 117
            |.|||||.|||.|||:.|..|::|||:   .|||:::|.:.:.|:|.:..:.|.|.|......:.
Mouse   122 WTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSS 186

  Fly   118 YAHFDDFQVDSETELYKLERVGKYSGTAGDSL-----------RYHINKRFSTFDRDNDESSKNC 171
            :|.:..|:|..:...|:| .:|:|||||||||           ..|...:|||:|||||....||
Mouse   187 FAQYQSFKVGDKKSFYEL-NIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNC 250

  Fly   172 AAEHGGGWWFHSCLSSSLNGLYFR---EGETGMLNGIHWGRWK--FQSLTFVQIMIRPKYF 227
            |.|...||||:.|.|::|||:|:|   ..||.  ||:.|..|.  :.||..|.:.|||..|
Mouse   251 AEEEQSGWWFNRCHSANLNGVYYRGSYRAETD--NGVVWYTWHGWWYSLKSVVMKIRPSDF 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 76/187 (41%)
Fgl1NP_663569.2 FReD 80..306 CDD:238040 75/186 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4167
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.