DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and FGB

DIOPT Version :10

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_005132.2 Gene:FGB / 2244 HGNCID:3662 Length:491 Species:Homo sapiens


Alignment Length:233 Identity:79/233 - (33%)
Similarity:117/233 - (50%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LMLPEE--EPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGD-------------PN 84
            |:.|:.  :|::| ....|....|.|||.|.||||:|.:.|..||.|||:             | 
Human   256 LIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLP- 319

  Fly    85 GEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSL 149
            ||:::|..|:..:||..|.||.|:::...|..|.||:..|.|.:|...|::. |.||.||||::|
Human   320 GEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQIS-VNKYRGTAGNAL 383

  Fly   150 --------------RYHINKRFSTFDRDND-----ESSKNCAAEHGGGWWFHSCLSSSLNGLYFR 195
                          ..|....|||:|||||     :..|.|:.|.|||||::.|.:::.||.|:.
Human   384 MDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYW 448

  Fly   196 EGE-------TGMLNGIHWGRWK--FQSLTFVQIMIRP 224
            .|:       .|..:|:.|..||  :.|:..:.:.|||
Human   449 GGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRP 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 79/233 (34%)
FGBNP_005132.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..75
Beta-chain polymerization, binding distal domain of another fibrin 45..47
Fib_alpha 91..234 CDD:462570
Fibrinogen_C 237..486 CDD:395095 77/231 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.