DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and FCN2

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_004099.2 Gene:FCN2 / 2220 HGNCID:3624 Length:313 Species:Homo sapiens


Alignment Length:213 Identity:77/213 - (36%)
Similarity:109/213 - (51%) Gaps:8/213 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SSPHTCP-----SGSPNGIHQLMLPEEEPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKD 78
            :.|.||.     ....:|.|.:.||:..|..| ....|....|.|.|||:||||:|.:.|.:||.
Human   100 TGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQ 164

  Fly    79 GFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSG 143
            |||...|||::|...::.:|.:...||.:.|........:|.:..|:|..|.|.|.|.......|
Human   165 GFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEG 229

  Fly   144 TAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHW- 207
            :|||||.:|.|:.|||.|:|||.::.|||....|.||:.:|..|:|||.|.|.......|||:| 
Human   230 SAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWK 294

  Fly   208 -GRWKFQSLTFVQIMIRP 224
             |:....|....::.:||
Human   295 SGKGYNYSYKVSEMKVRP 312

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 74/200 (37%)
FCN2NP_004099.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..99
FReD 102..312 CDD:238040 75/209 (36%)