DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and T15B7.1

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_504743.3 Gene:T15B7.1 / 188512 WormBaseID:WBGene00020516 Length:372 Species:Caenorhabditis elegans


Alignment Length:197 Identity:59/197 - (29%)
Similarity:95/197 - (48%) Gaps:24/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NGIHQLMLPEEEPFQVTQCKTTARDWIVIQRRLDGSVNF-NQSWFSYKDGFG--DPNGEFFIGLQ 92
            :|.:.:::..:|.......:|....|::.|.|.|.|.:: ::.|..||:|||  |.|..|::|.:
 Worm   157 SGTYTILVNGKETEVWCDMQTYGGGWVLFQNRFDDSESYWDRKWDEYKNGFGDVDENSNFWLGNE 221

  Fly    93 KLYLMTREQPHELFIQL-----KHGPGAT--VYAHFDDFQVDSETELYKL--------ERVGKYS 142
            .|::||..:...|.:::     .:...||  .:.|:.||||.|:|:.|.|        ..:|..|
 Worm   222 ALHVMTTNKKVTLRVEMYGDRTPNSKNATDFWFGHYFDFQVGSKTQNYPLLDLTMDWANPIGNAS 286

  Fly   143 GTAGDSLRYHINKRFSTFDRDNDESSKNCAAE-HGGGWWFHSCLSSSLNGLYF-REGETGMLNGI 205
             ||...|...|...|||.|..:| ..|.|..: ..||||..:|..|:|||.|. ::...|.  |:
 Worm   287 -TAWYDLTCSIGSPFSTIDNIHD-PVKECVTKFQMGGWWLKNCALSTLNGAYTPKDWNNGY--GM 347

  Fly   206 HW 207
            .|
 Worm   348 FW 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 59/197 (30%)
T15B7.1NP_504743.3 CLECT 21..138 CDD:214480
FReD 144..368 CDD:294064 59/197 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I3666
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.