DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Y43C5A.2

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_501883.1 Gene:Y43C5A.2 / 177911 WormBaseID:WBGene00012782 Length:452 Species:Caenorhabditis elegans


Alignment Length:238 Identity:65/238 - (27%)
Similarity:99/238 - (41%) Gaps:41/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQSSPHTCPSGSP-----------NGIHQLMLPEEEPFQVTQCKTTA-RDWIVIQRR--LDGSVN 68
            |.:.|.|.....|           :|: |.:.|...|.|| .|.||: ..:.|||.|  ...:||
 Worm   183 GSTLPPTTTPKPPMDCSEISNLTSSGV-QTIYPNGSPVQV-YCDTTSYGTYTVIQSRGATGENVN 245

  Fly    69 FNQSWFSYKDGFGDPNGE--FFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETE 131
            ||.::..|.|..|.|..|  |:.||..:..::..:|:.|.|.|..|........:..|:|.:...
 Worm   246 FNITYDKYTDIIGTPGKETNFWFGLDNMNHLSGAKPYRLQIDLCCGTLLVAKQIYHSFKVGTAEY 310

  Fly   132 LYKLERVGKYS--GTAGDSLRYHINKRFSTFDR--------DNDE----SSKNCAAEHGGGWWFH 182
            .|.|......|  |.|..|....:..:|||||.        |.||    ......::..||||:.
 Worm   311 GYNLTATADISGIGLAYSSTYTDLGAKFSTFDNFTGPLGKDDCDEFQYFDDSGVQSQPYGGWWYG 375

  Fly   183 SCLSSSLNGLYF--REGETGMLNGIHWGRWKFQSLTFVQIMIR 223
            || .::|||.::  |.|...:.:.:      |::.|.:.|.:|
 Worm   376 SC-GNNLNGFWYPKRNGNCTVPDEV------FKNTTMLGINMR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 62/228 (27%)
Y43C5A.2NP_501883.1 FReD 196..438 CDD:238040 61/225 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.