DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and C49C8.5

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_501481.2 Gene:C49C8.5 / 177668 WormBaseID:WBGene00016769 Length:451 Species:Caenorhabditis elegans


Alignment Length:245 Identity:61/245 - (24%)
Similarity:101/245 - (41%) Gaps:52/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQSSPHTCPSGSP----------NGIHQLMLPEEEPFQVTQC--KTTARDWIVIQRR-LDGS-VN 68
            |.:.|.|..:..|          :|:..:......|..| .|  |.:|..:.:||.| .:|| :.
 Worm   179 GPTEPPTTTAKLPSDCDEVESTSSGLQTIYPDGSTPVSV-YCDRKNSAGAYTIIQSRGREGSNIT 242

  Fly    69 FNQSWFSYKDGFGDP--NGEFFIGLQKL-YLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSET 130
            |:..:.:|.|.||:.  ...|::||..: .|.|..:.:.|.|.|..|........:.:|:|.::.
 Worm   243 FDIPFANYSDWFGESGVGKNFWLGLDNMNNLSTNGKTYSLQIDLCCGTQLMAKQLYTNFKVATKA 307

  Fly   131 ELYKLER------VG-KYSGTAGD-------SLRYHINK------RFSTFDRDNDESSKNCAAEH 175
            |.|.|..      :| .||.:|.|       .|.|.:.|      :|..:|.||..:.   .::.
 Worm   308 EQYALTASADLPGIGLDYSSSAKDLGAPFSTQLTYSLPKGKAECDQFEFYDDDNGGAG---PSKG 369

  Fly   176 GGGWWFHSCLSSSLNGLYF--REGETGMLNGIHWGRWKFQSLTFVQIMIR 223
            .||||:.|| .::|||..:  ..|:..:.        ||.|...:.|.:|
 Worm   370 YGGWWYGSC-GNNLNGFLYPNNNGDCSVT--------KFDSTLLLGINMR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 58/235 (25%)
C49C8.5NP_501481.2 FReD 190..437 CDD:294064 58/234 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.