Sequence 1: | NP_723894.2 | Gene: | CG31832 / 318970 | FlyBaseID: | FBgn0051832 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032021.1 | Gene: | Fcna / 14133 | MGIID: | 1340905 | Length: | 334 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 82/204 - (40%) |
---|---|---|---|
Similarity: | 110/204 - (53%) | Gaps: | 12/204 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 EVG----QSSPHTCPSGSPNGI-----HQLMLPEEEPFQV-TQCKTTARDWIVIQRRLDGSVNFN 70
Fly 71 QSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKL 135
Fly 136 ERVGKY-SGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGET 199
Fly 200 GMLNGIHWG 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31832 | NP_723894.2 | FReD | 28..225 | CDD:238040 | 77/188 (41%) |
Fcna | NP_032021.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 47..117 | 2/3 (67%) | |
Collagen | 65..106 | CDD:189968 | |||
FReD | 123..332 | CDD:238040 | 79/194 (41%) | ||
A domain, contributes to trimerization. /evidence=ECO:0000250 | 123..162 | 8/38 (21%) | |||
B domain, contributes to trimerization. /evidence=ECO:0000250 | 163..251 | 37/88 (42%) | |||
Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 | 290..292 | 0/1 (0%) | |||
P domain. /evidence=ECO:0000250|UniProtKB:O00602 | 325..334 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000029 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.810 |