DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and Fgb

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_862897.1 Gene:Fgb / 110135 MGIID:99501 Length:481 Species:Mus musculus


Alignment Length:233 Identity:80/233 - (34%)
Similarity:118/233 - (50%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LMLPEE--EPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGD-------------PN 84
            |:.|:.  :|::| ...||....|.|||.|.||||:|.:.|..||.|||:             | 
Mouse   246 LIQPDTSIKPYRVYCDMKTENGGWTVIQNRQDGSVDFGRKWDPYKKGFGNIATNEDAKKYCGLP- 309

  Fly    85 GEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSL 149
            ||:::|..|:..:||..|.||.|:::...|..|.||:..|.|.:|...|::. |.||.||||::|
Mouse   310 GEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEASKYQVS-VNKYKGTAGNAL 373

  Fly   150 --------------RYHINKRFSTFDRDND-----ESSKNCAAEHGGGWWFHSCLSSSLNGLYFR 195
                          ..|....|||:|||||     :..|.|:.|.|||||::.|.:::.||.|:.
Mouse   374 MDGASQLVGENRTMTIHNGMFFSTYDRDNDGWVTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYW 438

  Fly   196 EG-------ETGMLNGIHWGRWK--FQSLTFVQIMIRP 224
            .|       :.|..:|:.|..||  :.|:..:.:.|||
Mouse   439 GGLYSWDMSKHGTDDGVVWMNWKGSWYSMRRMSMKIRP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 80/233 (34%)
FgbNP_862897.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..81
Beta-chain polymerization, binding distal domain of another fibrin. /evidence=ECO:0000250 35..37
Fib_alpha 82..224 CDD:285864
FReD 227..476 CDD:294064 78/231 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 166 1.000 Inparanoid score I4167
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.