DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and LOC105947509

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_031760299.1 Gene:LOC105947509 / 105947509 -ID:- Length:304 Species:Xenopus tropicalis


Alignment Length:253 Identity:85/253 - (33%)
Similarity:117/253 - (46%) Gaps:57/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EVGQSSPHTCP--SGSPN--GIHQLMLPEEEPFQVTQCK-------------------------- 50
            |.|.:.|...|  .|.|.  |::.|       :..|.||                          
 Frog    67 ERGDTGPMGLPGQKGDPGDAGLYSL-------YNGTSCKDLLNQGEYLSGWNIITPVGMSPLRVL 124

  Fly    51 ----TTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKH 111
                |....|:|.|||.||:|:||..|.:||.|||....||::|...||.:|.....||.|.|:.
 Frog   125 CDMHTDGGGWLVFQRRWDGTVSFNVDWNTYKRGFGSEMNEFWLGNDILYNLTSSGTWELRIDLRD 189

  Fly   112 GPGATVYAHFDDFQVDSETELYKLERVGKYS-GTAGDSLRYHINKRFSTFDRDNDESSKNCAAEH 175
            ......||.:..||:..|...|.| .:|.|: |..||||..|....|||:||||:...:|||.::
 Frog   190 FDNNMYYAKYSFFQILGEDNNYTL-LLGSYNEGNIGDSLTPHNTVPFSTYDRDNNFLLENCAFDN 253

  Fly   176 GGGWWFHSCLSSSLNGLY--FREGETGMLNGIHW---GR--WKFQSLTFVQIMIRPKY 226
            .||||:::|..|:|||||  .:..||    ||:|   ||  :.::|   .::.||..|
 Frog   254 QGGWWYNNCYQSNLNGLYRLVQNNET----GINWLSDGRNHYSYKS---SEMKIRRLY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 80/236 (34%)
LOC105947509XP_031760299.1 Collagen <65..88 CDD:396114 6/20 (30%)
FReD 93..303 CDD:238040 76/217 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.