DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and si:zfos-2330d3.6

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_009294456.1 Gene:si:zfos-2330d3.6 / 103909555 ZFINID:ZDB-GENE-110411-23 Length:242 Species:Danio rerio


Alignment Length:175 Identity:71/175 - (40%)
Similarity:105/175 - (60%) Gaps:4/175 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 WIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAH 120
            |.|.|||:||||||.:.|..||.|||:..||:::||:.||.:||.:...|.:.|:...|...:|.
Zfish    68 WTVFQRRMDGSVNFFRPWEEYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRKGFAQ 132

  Fly   121 FDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCL 185
            :..|.|.||.|.|||:..|..:|.|||||.||...:|:|:|:|.|..::|||..:.|.:|:..|.
Zfish   133 YSSFSVGSEAEGYKLQVSGFTNGGAGDSLIYHSGMKFTTYDKDQDTHTQNCARIYVGAFWYKDCH 197

  Fly   186 SSSLNGLYF-REGETGMLNGIHWGRWK--FQ-SLTFVQIMIRPKY 226
            :::.||:|. .|.:|....|..|..||  |: .:.|:.:.|:|.|
Zfish   198 NANPNGVYLGGEDKTLFAIGNVWYTWKNNFEIGMKFITMKIKPVY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 69/172 (40%)
si:zfos-2330d3.6XP_009294456.1 FReD 23..241 CDD:238040 69/172 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.