DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and ANGPTL7

DIOPT Version :10

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_066969.1 Gene:ANGPTL7 / 10218 HGNCID:24078 Length:346 Species:Homo sapiens


Alignment Length:207 Identity:77/207 - (37%)
Similarity:117/207 - (56%) Gaps:14/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NGIHQLM------LPEEEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFI 89
            :|:::|.      .||.|.|  ...:|:...|.:||||..|.|:|.:.|..||.|||...|:|::
Human   142 SGVYKLPPDDFLGSPELEVF--CDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWL 204

  Fly    90 GLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAG-DSLRYHI 153
            |.:.::.::| ||..|.::::...|...||.:..|.:.:|...|:| .:|.|:|..| |:|:||.
Human   205 GNEHIHRLSR-QPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRL-FLGNYTGNVGNDALQYHN 267

  Fly   154 NKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGM-LNGIHWGRW--KFQSL 215
            |..|||.|:|||.....||....||:|::.|..|:|||:|:|.||... |:||.|..|  ...||
Human   268 NTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSL 332

  Fly   216 TFVQIMIRPKYF 227
            ..|::.|||:.|
Human   333 KRVEMKIRPEDF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 75/203 (37%)
ANGPTL7NP_066969.1 Mplasa_alph_rch <37..>109 CDD:275316
FReD 129..341 CDD:238040 74/202 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.