Sequence 1: | NP_723894.2 | Gene: | CG31832 / 318970 | FlyBaseID: | FBgn0051832 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_066969.1 | Gene: | ANGPTL7 / 10218 | HGNCID: | 24078 | Length: | 346 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 77/207 - (37%) |
---|---|---|---|
Similarity: | 117/207 - (56%) | Gaps: | 14/207 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 NGIHQLM------LPEEEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFI 89
Fly 90 GLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAG-DSLRYHI 153
Fly 154 NKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGM-LNGIHWGRW--KFQSL 215
Fly 216 TFVQIMIRPKYF 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31832 | NP_723894.2 | FReD | 28..225 | CDD:238040 | 75/203 (37%) |
ANGPTL7 | NP_066969.1 | SMC_N | <37..>109 | CDD:330553 | |
FReD | 129..341 | CDD:238040 | 74/202 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |