DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and si:ch211-157b11.8

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_009300879.1 Gene:si:ch211-157b11.8 / 101884863 ZFINID:ZDB-GENE-131127-436 Length:392 Species:Danio rerio


Alignment Length:259 Identity:80/259 - (30%)
Similarity:128/259 - (49%) Gaps:47/259 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LWTLLFEVGQSSPHTCPSGSP-----------------------NGIHQLMLPEEEPFQVTQCK- 50
            |..||..:..|.|::....:|                       |||:.:....::|.....|. 
Zfish   136 LLLLLKSITHSKPNSLKPRTPTVPPSAGLYPQDCHEIYQLGIKENGIYTIQPDPKQPALEAVCDM 200

  Fly    51 -TTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPG 114
             :....|.|.|||.||..:||::|..|:||||.|..|.::|...||.:|....|.|.|.|:....
Zfish   201 VSAGGGWTVFQRRFDGKTDFNRTWQEYRDGFGSPQTEHWLGNAVLYALTANGQHTLRITLQDWHE 265

  Fly   115 ATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRY-----HINKRFSTFDRDNDE-SSKNCAA 173
            .|.:|::::|:|..|.:.::| ...:|.|.||::..|     |..:.|||:|||:|. ::.|||.
Zfish   266 QTRHANYNNFKVAGENQRFRL-TAREYHGDAGNAFSYSKQYNHDGRAFSTYDRDHDRYAAGNCAR 329

  Fly   174 EHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHWGRW------------KFQSLTFVQIMIRPK 225
            .:|.||||.|||:::|||.::....:|:.:||:||.|            .|:|   |::..||:
Zfish   330 YYGAGWWFDSCLAANLNGRFYHGRYSGITDGIYWGTWYILTEYRTGERYSFKS---VEMKTRPR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 74/239 (31%)
si:ch211-157b11.8XP_009300879.1 FReD 165..390 CDD:238040 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.