DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and fcn2l

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_004917606.2 Gene:fcn2l / 101735093 XenbaseID:XB-GENE-22167163 Length:301 Species:Xenopus tropicalis


Alignment Length:221 Identity:73/221 - (33%)
Similarity:109/221 - (49%) Gaps:25/221 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLFLWTLLFEVGQSSPHTCPSGSPNGIHQLMLPEEEPFQV-TQCKTTARDWIVIQRRLDGSVNFN 70
            ||..|.:::              |:|:        :|.:| ....|....|||.|||.||||:|.
 Frog   102 VLSDWYIIY--------------PDGV--------QPMKVLCDMHTDGGGWIVFQRRWDGSVDFF 144

  Fly    71 QSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKL 135
            :.|.|||.|||....||::|...|:.:|.....||.:.|:....|..:|.::.|::..|:|.:||
 Frog   145 RDWKSYKSGFGSRLNEFWLGNDNLHKLTSSGTWELRVDLQDFENAKHFAKYESFRILGESEKFKL 209

  Fly   136 ERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETG 200
            .......|...|:::.|....|||.|:|||...::||..:.||||::.|..|:|||||.....:.
 Frog   210 LIGAMKGGNIEDAMKVHNTMPFSTKDQDNDILPEHCADRYKGGWWYNGCHHSNLNGLYLLGSHSN 274

  Fly   201 MLNGIHW--GRWKFQSLTFVQIMIRP 224
            ...||:|  ||....|....::.|||
 Frog   275 TAEGINWYGGRGHNYSYKRSEMKIRP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 70/200 (35%)
fcn2lXP_004917606.2 Collagen 38..>79 CDD:396114
FReD 91..300 CDD:238040 71/219 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.