DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and angpt2

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_017949917.2 Gene:angpt2 / 101731563 XenbaseID:XB-GENE-487765 Length:498 Species:Xenopus tropicalis


Alignment Length:204 Identity:80/204 - (39%)
Similarity:116/204 - (56%) Gaps:9/204 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NGIHQLMLPEEEPFQVTQC--KTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQK 93
            |||:.|.:........|.|  ||....|.:||:|.||||:|:::|..||.|||||.||:::|.:.
 Frog   297 NGIYTLTILNTTDQAKTYCDMKTDGGGWTIIQKRFDGSVDFHRTWKEYKKGFGDPAGEYWLGNEL 361

  Fly    94 LYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAG--DSLRYHINKR 156
            :..:|..|.:.|.|||:...|...::.::.|.:.:|.:.|::...| |:||||  :|:....|. 
 Frog   362 VSQLTNLQKYVLKIQLRDWEGNQAFSLYEHFYLGNEAQKYRINLKG-YTGTAGKINSISQPGND- 424

  Fly   157 FSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGE-TGMLNGIHWGRWKFQ--SLTFV 218
            |||.|.|||:....|:....|||||.:|..|:|||:|:..|: |...|||.|..||..  ||...
 Frog   425 FSTKDADNDKCICKCSQMATGGWWFDACGPSNLNGMYYSMGQNTNKFNGIKWYYWKGSGYSLKAT 489

  Fly   219 QIMIRPKYF 227
            .:||||..|
 Frog   490 TMMIRPVDF 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 78/200 (39%)
angpt2XP_017949917.2 Mplasa_alph_rch <80..>249 CDD:275316
FBG 282..496 CDD:214548 78/200 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.