DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and mfap4.7

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_009294426.1 Gene:mfap4.7 / 100538070 ZFINID:ZDB-GENE-121214-96 Length:243 Species:Danio rerio


Alignment Length:223 Identity:81/223 - (36%)
Similarity:119/223 - (53%) Gaps:23/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LFEVGQSSPHTCPSGSPNGIHQLMLPEEEPFQVTQCKTTAR-------DWIVIQRRLDGSVNFNQ 71
            :::.||:.         :||:.:....:.|..| .|:..:|       .|.|.|||:|||:||.|
Zfish    30 IYKSGQTG---------SGIYSIYPAGDTPVWV-YCEMVSRMMDGFNGGWTVFQRRMDGSINFYQ 84

  Fly    72 SWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLE 136
            .|..||.|||...||:::||:.||.:||::...|.:.|:...|...:|.:..|.|.||.|.|||:
Zfish    85 PWEEYKKGFGTTEGEYWLGLENLYQLTRQKKFMLKVDLEDFTGRRGFAQYSSFSVGSEAEGYKLQ 149

  Fly   137 RVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGM 201
            ......|.|||||.||...:|||||:|.|.|.||||..:.|.:|:..|..::.||:|. .||...
Zfish   150 VSAFTDGGAGDSLAYHNQMKFSTFDKDQDNSVKNCAKLNLGAFWYRDCHHTNPNGVYL-WGEDAT 213

  Fly   202 LNGIH--WGRW--KFQS-LTFVQIMIRP 224
            :.||.  |..|  |:.: |..:.:.|:|
Zfish   214 IFGIGNVWYAWTNKYATGLKSITMKIKP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 79/209 (38%)
mfap4.7XP_009294426.1 FReD 24..242 CDD:238040 81/223 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.