DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and mfap4.8

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_003197840.1 Gene:mfap4.8 / 100538028 ZFINID:ZDB-GENE-121214-168 Length:243 Species:Danio rerio


Alignment Length:243 Identity:87/243 - (35%)
Similarity:124/243 - (51%) Gaps:21/243 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSCFFVLFLWTLLFE--VGQSSPHTC----PSG-SPNGIHQLMLPEEEPFQVTQCKTTA----- 53
            |....||:.|.::...  |....|..|    .|| :.:||:.:....:.|..| .|:..:     
Zfish     1 MAMTVFVVALLSVFTASVVSGFKPFDCSEIYKSGQTVSGIYSIYPAGDTPVWV-YCQMVSDGKVE 64

  Fly    54 --RDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGAT 116
              ..|.|.|||:|||::|.|.|..|:.|||...||:::||:.||.:||.:...|.:.|:...|..
Zfish    65 ENEGWTVFQRRMDGSIHFFQLWEKYRIGFGTTEGEYWLGLENLYQLTRHKKFMLRVDLEDFTGRR 129

  Fly   117 VYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWF 181
            .:|.:..|.|.||.|.||||..|...|.|||||.||...:|||:|||.|.:..|||....|.:|:
Zfish   130 GFAQYSSFSVGSEVEGYKLELSGFTDGGAGDSLSYHNGMKFSTYDRDQDTNEDNCARMRLGAFWY 194

  Fly   182 HSCLSSSLNGLYFREGETGMLNG--IHWGRWKFQSLT---FVQIMIRP 224
            ..|..::.||:|. .||....||  |:|..||..:.|   |:.:.|:|
Zfish   195 KGCNYANPNGVYL-WGEDKSKNGIAINWYTWKNDNETPMKFITMKIKP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 79/210 (38%)
mfap4.8XP_003197840.1 FReD 24..242 CDD:238040 82/220 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.