DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and LOC100496379

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_031746585.1 Gene:LOC100496379 / 100496379 -ID:- Length:490 Species:Xenopus tropicalis


Alignment Length:236 Identity:79/236 - (33%)
Similarity:119/236 - (50%) Gaps:36/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSC-----FFVLFL-WTLLFEVGQSSPHTCPSGSPNGIHQLMLPEEEPFQV-TQCKTTARDWIV 58
            :|:|     :.|||. |..::              |:|        .:|..| ....|....|||
 Frog   278 VKNCMELRTYGVLFSGWYTIY--------------PDG--------NKPLNVLCDMHTDGGGWIV 320

  Fly    59 IQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDD 123
            .|:|:||||:|.:.|.||:.|||....||::|.:.::.:|.....:|.|.|:.......||.:..
 Frog   321 FQKRMDGSVDFYRDWGSYRQGFGSQLSEFWLGNENIHRLTSSGNIQLRIDLEDFDNNRTYATYSQ 385

  Fly   124 FQVDSETELYKLERVGKYS-GTAGDSLRYHINKRFSTFDRDNDES-SKNCAAEHGGGWWFHSCLS 186
            |:::.|::.|.| |:|.:: |||||||..|.||.|::.|.|.||| :.|||.::.|.||:..|..
 Frog   386 FRLEPESQKYTL-RLGAFTGGTAGDSLSSHNNKAFASKDADYDESVNSNCAEKYKGAWWYVKCYD 449

  Fly   187 SSLNGLYFREGETGM-LNGIHWGRWK--FQSLTFVQIMIRP 224
            :.|||.|.| |..|. ..||.|..::  ..||...::..||
 Frog   450 ACLNGEYLR-GPLGQNYGGIAWKTFRGYNYSLKKSEMKFRP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 73/203 (36%)
LOC100496379XP_031746585.1 Collagen 91..144 CDD:396114
Collagen <213..270 CDD:396114
FReD 276..490 CDD:238040 79/236 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.