DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and angptl5

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_031752234.1 Gene:angptl5 / 100493165 XenbaseID:XB-GENE-479274 Length:347 Species:Xenopus tropicalis


Alignment Length:205 Identity:75/205 - (36%)
Similarity:113/205 - (55%) Gaps:27/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PNGIHQLMLPEEE--PFQVTQCKTTAR--DWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIG 90
            |:|:: ::.||..  ||:.. |....:  .|.|||:|:||||:|.:||..|.:||||.:|||::|
 Frog   123 PSGLY-IIQPEGTYYPFEAF-CDMDYQGGGWTVIQKRIDGSVDFQRSWIDYMEGFGDLSGEFWLG 185

  Fly    91 LQKLY--LMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLR--- 150
            |:|.:  |..:.....|.|.|:...|...||.:|.|.::.|:..: :..||:|||||||:||   
 Frog   186 LKKTFCILNQKNTSFMLSIALEAEDGTLAYASYDSFWLEDESNQF-IMHVGRYSGTAGDALRGFK 249

  Fly   151 YHINKR---FSTFDRDNDESSKNCAA-----------EHGGGWWFHSCLSSSLNGLYFREGETGM 201
            ...|:.   |||||.|||..:.:|..           .:..||||..|..::|||:: :......
 Frog   250 KEDNQNAMPFSTFDADNDRCNPSCTVNGKSINSCSLLNNRSGWWFSQCGLANLNGVH-KVTRLVD 313

  Fly   202 LNGIHWGRWK 211
            ::||||..||
 Frog   314 ISGIHWNTWK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 75/205 (37%)
angptl5XP_031752234.1 FReD 108..340 CDD:238040 75/205 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.