DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and tnn

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_017949080.2 Gene:tnn / 100491528 XenbaseID:XB-GENE-998034 Length:1109 Species:Xenopus tropicalis


Alignment Length:179 Identity:75/179 - (41%)
Similarity:112/179 - (62%) Gaps:9/179 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTRE--QPHELFIQLKHG 112
            :|....|||.|||..|.::|.|.|.:|.:|||||:.||::||:.::.:|..  ..:|:.:.|:.|
 Frog   932 ETDGGGWIVFQRRNSGKLDFYQRWRTYVEGFGDPSDEFWLGLEWIHKLTSSPGNNYEIRVDLRAG 996

  Fly   113 PGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGG 177
             ..:|||.:.:|:|.|..:.|||. :..|||||||.|.||...:|||:|:|||.:..|||..|.|
 Frog   997 -DESVYAFYRNFRVGSSKDRYKLS-ISDYSGTAGDGLTYHNGWKFSTWDKDNDIALTNCALSHRG 1059

  Fly   178 GWWFHSCLSSSLNGLYFREGETGMLNGIHWGRWKFQ--SLTFVQIMIRP 224
            .:|:.:|..::|||.|   ||||...|::|..||..  |:.||::.:||
 Frog  1060 AFWYKNCHLANLNGQY---GETGHSQGVNWEPWKGHEFSVPFVEMKMRP 1105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 75/179 (42%)
tnnXP_017949080.2 exchanger_TraA <124..432 CDD:411343
fn3 449..513 CDD:394996
fn3 543..619 CDD:394996
fn3 630..707 CDD:394996
fn3 716..788 CDD:394996
fn3 803..879 CDD:394996
FReD 895..1105 CDD:238040 73/177 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.