Sequence 1: | NP_723894.2 | Gene: | CG31832 / 318970 | FlyBaseID: | FBgn0051832 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031747219.1 | Gene: | tnxb / 100489649 | XenbaseID: | XB-GENE-481849 | Length: | 2840 | Species: | Xenopus tropicalis |
Alignment Length: | 200 | Identity: | 74/200 - (37%) |
---|---|---|---|
Similarity: | 120/200 - (60%) | Gaps: | 10/200 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 NGIHQLML--PEEEPFQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQ 92
Fly 93 KLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRF 157
Fly 158 STFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHWGRWK-FQ-SLTFVQI 220
Fly 221 MIRPK 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31832 | NP_723894.2 | FReD | 28..225 | CDD:238040 | 73/198 (37%) |
tnxb | XP_031747219.1 | EGF_Tenascin | 179..206 | CDD:376143 | |
exchanger_TraA | <400..779 | CDD:411343 | |||
EGF_Tenascin | 799..826 | CDD:376143 | |||
fn3 | 834..913 | CDD:394996 | |||
FN3 | 923..998 | CDD:214495 | |||
fn3 | 1790..1852 | CDD:394996 | |||
fn3 | 1881..1960 | CDD:394996 | |||
fn3 | 1972..2051 | CDD:394996 | |||
fn3 | 2064..2141 | CDD:394996 | |||
fn3 | 2170..2245 | CDD:394996 | |||
fn3 | 2267..2338 | CDD:394996 | |||
FN3 | 2356..2433 | CDD:238020 | |||
fn3 | 2445..2522 | CDD:394996 | |||
fn3 | 2531..2609 | CDD:394996 | |||
FReD | 2622..2831 | CDD:238040 | 72/197 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000029 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X25 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |