DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and LOC100334800

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001315009.1 Gene:LOC100334800 / 100334800 -ID:- Length:246 Species:Danio rerio


Alignment Length:223 Identity:78/223 - (34%)
Similarity:117/223 - (52%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QSSPHTCP----SGSPNGIHQLMLPEEEPFQVTQCKTTAR-------DWIVIQRRLDGSVNFNQS 72
            :|.|..|.    ||..:.....:..::.|..| .|...:.       .|.|||:|:|||:||.:.
Zfish    25 RSRPCDCSDLHRSGERSSRTHTVYIDDSPINV-DCHMISEGREDEHGGWTVIQKRMDGSLNFYRP 88

  Fly    73 WFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLER 137
            |..||.|||.|.||.::||:.::.:||.:.:.|.:.::...|....||:..|.||.|.:.|||..
Zfish    89 WKEYKRGFGTPEGEHWLGLENIHRITRNKKYMLRVDIEDFGGRKGCAHYSSFSVDCEEDGYKLHV 153

  Fly   138 VGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLY-FREGETGM 201
            .|...|.|||||..|.|::|||||:|.|:..||||.|..||:|:..|..::.||:| :....|..
Zfish   154 SGFRDGGAGDSLSSHNNQKFSTFDKDQDDYKKNCAREFLGGFWYKKCHHANPNGVYLWGHDRTHY 218

  Fly   202 LNGIHWGRWK---FQSLTFVQIMIRPKY 226
            ..|:.|..|.   :.||.::.:.|:..|
Zfish   219 AIGVCWWSWDHNYYNSLKYISMKIKRIY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 73/207 (35%)
LOC100334800NP_001315009.1 FReD 28..245 CDD:238040 76/217 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.