DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and angptl1

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001123408.1 Gene:angptl1 / 100170184 XenbaseID:XB-GENE-482123 Length:487 Species:Xenopus tropicalis


Alignment Length:236 Identity:86/236 - (36%)
Similarity:134/236 - (56%) Gaps:34/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PHTCPSGSPNGIHQLMLPEEEPFQVTQ---------------------------CKTT--ARDWI 57
            |...|:.||..|..:.:.:|.||:..|                           |:.:  ...|.
 Frog   251 PPQAPTSSPFRIPPVTIIDEGPFRDCQHAKESGFSNSGIYLIKPDNANSPMQLWCENSLDPGGWA 315

  Fly    58 VIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFD 122
            |||||:|||.||.::|.:||.|||:.:.|:::||:.:|.:|.:..:.|.|:|:......|||.:.
 Frog   316 VIQRRIDGSANFFRNWETYKKGFGNIDAEYWLGLENIYQLTNQDNYRLLIELEDWSNKKVYAEYS 380

  Fly   123 DFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSS 187
            .|:::||:|.||| |:|.|.|.||||:.:|..|:|:|.|||.|..|.|||..|.||||:::|..:
 Frog   381 SFRLESESEFYKL-RLGTYQGNAGDSMIWHNGKQFTTLDRDKDMYSGNCAHFHKGGWWYNACAHA 444

  Fly   188 SLNGLYFREG--ETGMLNGIHWGRWK--FQSLTFVQIMIRP 224
            :|||:::|.|  .:...:||:|..::  ..||..||::|||
 Frog   445 NLNGVWYRGGHYRSKHQDGIYWAEYRGGSYSLKAVQMLIRP 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 84/230 (37%)
angptl1NP_001123408.1 FReD 271..486 CDD:238040 80/216 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.