DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and fibcd1a

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_005166963.1 Gene:fibcd1a / 100151577 ZFINID:ZDB-GENE-081105-148 Length:464 Species:Danio rerio


Alignment Length:220 Identity:87/220 - (39%)
Similarity:124/220 - (56%) Gaps:17/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SSPHTC----PSGS-PNGIHQLMLPEEEP--FQV-TQCKTTARDWIVIQRRLDGSVNFNQSWFSY 76
            |.|..|    .||. .:||:. :.|...|  ||| ....|....|.|||||.||||||.:.|.:|
Zfish   241 SRPRDCSDIYASGQREDGIYS-VFPTHYPAGFQVFCDMTTDGGGWTVIQRREDGSVNFFRDWEAY 304

  Fly    77 KDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDD-----FQVDSETELYKLE 136
            ::|||...||.::|:::::.:|.:..:||.|.|:....:|.:|.:..     |.||.:.:.|.|.
Zfish   305 REGFGKITGEHWLGMKRIHALTIQANYELRIDLEDFENSTSFAQYGSFGVGLFSVDPDEDGYPLS 369

  Fly   137 RVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLYFREGETGM 201
             :..|||||||||..|...:|:|.|:|||.|..|||:.:.|.||:.:|.:|:|||.|.|...|..
Zfish   370 -IADYSGTAGDSLLKHNGMKFTTKDKDNDHSENNCASFYHGAWWYRNCHTSNLNGQYLRGQHTSY 433

  Fly   202 LNGIHWGRWK-FQ-SLTFVQIMIRP 224
            .:||.|..|. :| ||.|.::.|||
Zfish   434 ADGIEWSSWTGWQYSLKFTEMKIRP 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 83/208 (40%)
fibcd1aXP_005166963.1 FReD 243..458 CDD:238040 84/216 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.