DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and tnr

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001107287.1 Gene:tnr / 100135076 XenbaseID:XB-GENE-948286 Length:1350 Species:Xenopus tropicalis


Alignment Length:176 Identity:75/176 - (42%)
Similarity:110/176 - (62%) Gaps:7/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGA 115
            |.|..|||.|||.:|..:|.:.|..|:.|||:...||::||..|:.:|.:..:||.|.::.|..|
 Frog  1167 TDAGGWIVFQRRQNGLTDFFRKWADYRVGFGNLEDEFWLGLDTLHQVTSQGRYELRIDMRDGQEA 1231

  Fly   116 TVYAHFDDFQVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWW 180
             |||:::.|.:.....|||| |:|.::||:||||.||..:.|||.|||||.:..|||:.:.|.||
 Frog  1232 -VYAYYNKFNIGDARSLYKL-RIGDFNGTSGDSLTYHQGRPFSTKDRDNDVAVTNCASSYKGAWW 1294

  Fly   181 FHSCLSSSLNGLYFREGETGMLNGIHWGRWKFQ--SLTFVQIMIRP 224
            :.:|..::|||.|   ||:....||:|..||..  |:.||::.:||
 Frog  1295 YKNCHRTNLNGKY---GESRHSQGINWYHWKGHEFSIPFVEMKMRP 1337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 75/176 (43%)
tnrNP_001107287.1 EGF_alliinase 153..196 CDD:282688
EGF_2 198..223 CDD:285248
EGF_2 260..285 CDD:285248
EGF_2 292..316 CDD:285248
FN3 321..410 CDD:238020
fn3 413..493 CDD:278470
fn3 502..582 CDD:278470
FN3 592..676 CDD:238020
fn3 684..763 CDD:278470
fn3 773..840 CDD:278470
fn3 862..939 CDD:278470
fn3 949..1018 CDD:278470
FN3 1037..1122 CDD:238020
FReD 1129..1337 CDD:238040 73/174 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.