DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31832 and mfap4.4

DIOPT Version :9

Sequence 1:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001103327.2 Gene:mfap4.4 / 100126131 ZFINID:ZDB-GENE-071004-9 Length:242 Species:Danio rerio


Alignment Length:233 Identity:84/233 - (36%)
Similarity:125/233 - (53%) Gaps:25/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CFFVLFLWTLLFEVGQ--SSPHTC-PSG-SPNGIHQLMLPEEEPFQVTQCKTTARD-----WIVI 59
            |.|:.|..:.::..|:  |..:|. |:| ||..::..|:.|            .:|     |.||
Zfish    19 CRFMQFDCSDIYNSGETLSGAYTIYPAGDSPVWVYCQMVSE------------GKDEDNGGWTVI 71

  Fly    60 QRRLDGSVNFNQSWFSYKDGFGDPNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDF 124
            |||:||||||.:.|..||.|||:..||:::||:.||.:||.:...|.:.|:...|...:|.:..|
Zfish    72 QRRMDGSVNFYRPWRDYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSF 136

  Fly   125 QVDSETELYKLERVGKYSGTAGDSLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSL 189
            .|..|.|.|||:..|...|.||||:..|...:|||||:|.|...||||.|:.|.:|:..|.:::.
Zfish   137 SVGCECEGYKLQVSGFTDGGAGDSMTPHNEMKFSTFDKDQDTYEKNCAKEYLGAFWYGYCHNTNP 201

  Fly   190 NGLYFREGE-TGMLNGIHWGRWK---FQSLTFVQIMIR 223
            ||:|..|.: |....|:.|..||   ..||.::.:.|:
Zfish   202 NGVYLWEDDSTHFAIGVTWYSWKNTHDMSLKYISMKIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31832NP_723894.2 FReD 28..225 CDD:238040 77/206 (37%)
mfap4.4NP_001103327.2 FReD 25..239 CDD:238040 80/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48118
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.